CDS

Accession Number TCMCG044C84131
gbkey CDS
Protein Id YP_009234997.1
Location complement(63186..63302)
Gene psbL
GeneID 26895716
Organism Papaver somniferum

Protein

Length 38aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA313679
db_source NC_029434.1
Definition photosystem II protein L (chloroplast) [Papaver somniferum]

EGGNOG-MAPPER Annotation

COG_category C
Description One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface and is required for correct PSII assembly and or dimerization
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00194        [VIEW IN KEGG]
KEGG_ko ko:K02713        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00195        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
map00195        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009534        [VIEW IN EMBL-EBI]
GO:0009535        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009579        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0031976        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0034357        [VIEW IN EMBL-EBI]
GO:0042651        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044436        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0055035        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGACACAATCAAACCCGAACGAACAAAATGTTGAATTGAATCGTACCAGTCTTTACTGGGGGTTATTACTCATTTTTGTACTTGCTGTTTTATTTTCCAATTATTTCTTCAATTAA
Protein:  
MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN